PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011056.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 304aa    MW: 31085.5 Da    PI: 7.8133
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011056.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1191.8e-373995460
      zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                ++++cprCds ntkfCyynny+l+qPr+fCkaCrryWtkGG lrnvPvGgg+rk k 
  Do011056.1 39 AEVRCPRCDSPNTKFCYYNNYNLAQPRHFCKACRRYWTKGGHLRNVPVGGGCRKPKP 95
                5789**************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.1E-324094IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5184195IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-264294IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MHELQSIQGL AGRLFGGGAA ANGLLRRHGG SAAVQWEAAE VRCPRCDSPN TKFCYYNNYN  60
LAQPRHFCKA CRRYWTKGGH LRNVPVGGGC RKPKPKRPAA VDGSSNNGVH GAHRDGKTPR  120
SGCGGASSSS TPAADGDAPP VSSAFSAVTE PSGPTIISGG FVEASAGTGH FAAGDTRTLL  180
VPPPAPMFAD QAAVFASLFA SPRPLPAFFS SSAQAQLKAE EHVASLLAEQ QSPASPAAAA  240
GTAPPFSGRS DGALAAGASD WPTAASDTGI FELTGGIAGD VSLPAYWNTG SWTDPDPDPT  300
IYLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3749732e-65AK374973.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3081L07.
GenBankAM0843522e-65AM084352.1 Hordeum vulgare subsp. vulgare dof4 gene for dof zinc finger protein 4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965236.11e-114PREDICTED: uncharacterized protein LOC101774857
TrEMBLK3XYK31e-114K3XYK3_SETIT; Uncharacterized protein
STRINGSi007011m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-33DOF zinc finger protein 1